AnaSpec Introduces Twenty-Six New Catalog Peptides
Released on = June 15, 2007, 10:57 am
Press Release Author = AnaSpec Inc.
Industry =
Press Release Summary = This week AnaSpec, one of the world's largest providers of custom and catalog peptides, introduced twenty-six (26) new peptides for drug discovery research.
Press Release Body = June 15, 2007 - San Jose, CA
This week AnaSpec, one of the world's largest providers of custom and catalog peptides, introduced twenty-six (26) new peptides for drug discovery research.
LL-37; Antimicrobial Peptide; human - Cat# 61302, 1 mg Antimicrobial peptide LL-37; belonging to the cathelicidin family; is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defence against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells ; LL-37 is significantly resistant to proteolytic degradation in solution. [LL-37, 37 aa] H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
mCRAMP; mouse - Cat# 61305, 1 mg This cathelicidin-related antimicrobial peptide (mCRAMP) is a sole murine cathelicidin. The mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans. GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH
rCRAMP - Cat# 61306, 1 mg This peptide is a rat homologue of the human cathelicidin LL-37. Rat cathelicidin-related antimicrobial peptide (rCRAMP) was identified in granulocytes; thymus; testis; lung; mouth mucosa; tongue; oesophagus; colon; caecum and small intestine. The rCRAMP peptide is present in specific CNS regions and may play a role in the innate immunity of the CNS. rCRAMP exhibits pro-healing activity in stomach. GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ H-Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln-OH
CAP-18; rabbit - Cat# 61307, 1 mg This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37); mice (mCRAMP); rats (rCRAMP); and sheep (SMAP29 and SMAP34). GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY H-Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr-OH
SMAP 29; Sheep Myeloid Antimicrobial Peptide 29 - Cat# 61308, 1 mg This 29 amino acid sheep myeloid antimicrobial peptide 29 (SMAP 29) displays extremely high antimicrobial activity against Pseudomonas strains; other gram-negative bacteria; and multidrug-resistant pathogens. SMAP 29 is a broad-spectrum antibiotic cathelicidin; it is active in both low- and high-ionic-strength conditions; and induces significant morphological alterations in bacterial surfaces. RGLRRLGRKIAHGVKKYGPTVLRIIRIAG H-Arg-Gly-Leu-Arg-Arg-Leu-Gly-Arg-Lys-Ile-Ala-His-Gly-Val-Lys-Lys-Tyr-Gly-Pro-Thr-Val-Leu-Arg-Ile-Ile-Arg-Ile-Ala-Gly-OH
LL-37 pentamide - Cat# 61309, 1 mg This synthetic peptide is a modification of the LL-37 cathelicidin peptide in which each aspartic acid of LL-37 is replaced by an asparagines; and each glutamic acid is replaced by a glutamine. LL-37 pentamide\'s anti-staphylococcal activity is greater than that of original LL-37 because multiple acidic residues of human LL-37 reduce its efficacy against Staphylococci. LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS H-Leu-Leu-Gly-Asn-Phe-Phe-Arg-Lys-Ser-Lys-Gln-Lys-Ile-Gly-Lys-Gln-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asn-Phe-Phe-Arg-Asn-Leu-Val-Pro-Arg-Thr-Gln-Ser-OH
OV-1; Sheep - Cat# 61310, 1 mg This alpha-helical antimicrobial OV-1 ovispirin peptide is derived from SMAP29 peptide. It was found to inhibit several antibiotic-resistant bacterial strains including mucoid and nonmucoid Pseudomonas aeruginosa. KNLRRIIRKIIHIIKKYG H-Lys-Asn-Leu-Arg-Arg-Ile-Ile-Arg-Lys-Ile-Ile-His-Ile-Ile-Lys-Lys-Tyr-Gly-OH
OV-2; Sheep - Cat# 61311, 1 mg This alpha-helical 14-amino-acid SMAP29 derivative was found to inhibit mucoid and nonmucoid Pseudomona. aeruginosa strains. LRRIIRKIIHIIKK-NH2 H-Leu-Arg-Arg-Ile-Ile-Arg-Lys-Ile-Ile-His-Ile-Ile-Lys-Lys-NH2
Stromal Target Antigen - Cat# 61297, 1 mg This peptide can be the target for the antigen-specific T cells that can also indirectly eliminate the cancer antigen-loss variant cells by eliminating the tumor stroma that cross-presented on this target antigen. This peptide is a candidate anti-cancer drug. SIYYYRYGL H-Ser-Ile-Tyr-Tyr-Tyr-Arg-Tyr-Gly-Leu-OH
[-2] pPSA; Prostate-Specific Antigen; truncated - Cat# 61271, 1 mg This peptide is a truncated form of precursor Prostate-Specific Antigen (pPSA). The peptide was identified in prostate tumor extracts consisting of PSA with a serine-arginine pro leader peptide ([-2]pPSA) instead of the normally expressed 7 amino acid pro leader peptide. The antigen is also enriched in cancer cell secretions. This form of pPSA is enzymatically inactive. SRIVGGWECEK H-Ser-Arg-Ile-Val-Gly-Gly-Trp-Glu-Cys-Glu-Lys-OH
[APLILSR]pPSA - Cat# 61272, 1 mg This form of the pro Prostate-Specific Antigen (pPSA) contains the pro leader peptide and N-terminal tryptic fragment of PSA. The pro leader peptide; APLILSR is necessary for secretion from mammalian cells and is removed extracellularly to produce active; mature PSA. APLILSRIVGGWECEK H-Ala-Pro-Leu-Ile-Leu-Ser-Arg-Ile-Val-Gly-Gly-Trp-Glu-Cys-Glu-Lys-OH
G154; gp100 (154-162) - Cat# 61274, 1 mg This peptide was isolated directly from MHC-associated HLA-A*0201 molecules of human melanoma cells. G154 peptide amino acids 154 to 162 is a naturally processed epitope for HLA-A*0201-restricted melanoma-reactive cytotoxic T lymphocytes (CTLs). It appears to be the most abundant among the other peptides from the gp100 group at the cell surface. KTWGQYWQV H-Lys-Thr-Trp-Gly-Gln-Tyr-Trp-Gln-Val-OH
G209-2M; gp100 (209-217) - Cat# 61277, 1 mg This modified gp100 peptide amino acids 209 to 217 is a MHC-associated HLA-A2.1-restricted epitope derived from melanoma antigene. It can be processed; presented; and recognized by T cells. Alteration of the G209 peptide to G209-2M at the second amino acid changing threonine to a methionine was found to increase the affinity for MHC-associated HLA-A2.1 resulting in enhanced induction of T cells reactive to native gp100 IMDQVPFSV H-Ile-Met-Asp-Gln-Val-Pro-Phe-Ser-Val-OH
G209; gp100 (209-217) - Cat# 61276, 1 mg This peptide gp100 amino acids 209 to 217 is the most well characterized and most commonly used epitope in melanoma studies. G209 sequence was isolated directly from MHC-associated HLA-A*0201 molecules of human melanoma cells. ITDQVPFSV H-Ile-Thr-Asp-Gln-Val-Pro-Phe-Ser-Val-OH
G280-9V; gp100(280-288) Lys(biotin) - Cat# 61278, 1 mg This modified G280 melanoma antigen gp100; amino acids 280 to 288; is a high affinity epitope for MHC-associated HLA- A. Immunization with this peptide elicits CD8+ immunity and induces Ag-specific cytotoxic T lymphocytes (CTL). It has higher class I MHC-binding affinity than original G280-9 peptide. This peptide is biotinylated at the side chain of lysine at the C-terminus. YLEPGPVTV-K(Biotin) H-Tyr-Leu-Glu-Pro-Gly-Pro-Val-Thr-Val-Lys(Biotin)
G280-9; gp100 (280-288); Lys (biotin) - Cat# 61280, 1 mg This is a biotinylated form of the G280-9 peptide; a common melanoma gp100 epitope restricted by MHC-associated HLA-A2. The G280-9 sequence is unique because it could be recognized by cytotoxic T lymphocytes at very low concentrations; however it shows low total immunogenicity that may be attributable to relatively low affinity of this peptide for the HLA-A2. YLEPGPVTA-K(Biotin) H-Tyr-Leu-Glu-Pro-Gly-Pro-Val-Thr-Ala-Lys(Biotin)
Leuprolide acetate; truncated - Cat# 61291, 1 mg This is a truncated form of the leuprolide acetate; a synthetic gonadotropin-releasing hormone (GnRH) analogue. It is currently being proposed to control symptoms in women with functional bowel disease. It also inhibits pituitary gonadotropin secretion and suppresses steroidogenesis. . Y-l*-LRP-NHEt;
CREB2 (91-116) - Cat# 61284, 1 mg This peptide is a fragment amino acids 91 to 116 of the cyclic AMP-responsive DNA-binding protein (CREB2). This protein binds the cAMP response element (CRE); present in many viral and cellular promoters. CREB stimulates transcription on binding to the cAMP response element. CREB2 is a cellular transactivator of the bovine leukemia virus. ESEDSQESVDSVTDSQKRREILSRRP H-Glu-Ser-Glu-Asp-Ser-Gln-Glu-Ser-Val-Asp-Ser-Val-Thr-Asp-Ser-Gln-Lys-Arg-Arg-Glu-Ile-Leu-Ser-Arg-Arg-Pro-OH
CREB327 (113-126) - Cat# 61285, 1 mg This is a fragment of the cyclic AMP-responsive DNA-binding protein (CREB)327 /active transcription factor CREB-A amino acids 113 to 126. The alternatively spliced CREB isoform CREB327 is expressed on the mRNA level. CREB327 and CREB341 are the most abundant isoforms of CREB arising from alternative splicing of a 42-bp exon. ILSRRPSYRKILND H-Ile-Leu-Ser-Arg-Arg-Pro-Ser-Tyr-Arg-Lys-Ile-Leu-Asn-Asp-OH
[pS119] CREB327 (113-126); Biotinyl - Cat# 61288, 1 mg This is a biotinylated fragment of the phosphorylated CREB327/active transcription factor CREB-A; amino acids 113 to 126; paired to non- phosphorylated CREB327. It is a PKA phosphorylation substrate. Biotin-ILSRRP(pS)YRKILND Biotin-Ile-Leu-Ser-Arg-Arg-Pro-pSer-Tyr-Arg-Lys-Ile-Leu-Asn-Asp-OH
Salusin-beta - Cat# 61283, 1 mg This salusin-b peptide belongs to the salusin family; newly discovered TOR-related peptides. TOR is a gene encoding a protein of the torsion dystonia family. Salusins are detected in many human tissues; plasma and urine; they are endocrine and/or paracrine factors. Hypotensive activity of salusin-ß is caused by depressing cardiac contractility. Administration of salusins to animals is associated with hypotension and bradycardia; salusins increase intracellular Ca2+ and induce cell mitogenesis. AIFIFIRWLLKLGHHGRAPP H-Ala-Ile-Phe-Ile-Phe-Ile-Arg-Trp-Leu-Leu-Lys-Leu-Gly-His-His-Gly-Arg-Ala-Pro-Pro-OH
Salusin-alpha - Cat# 61282, 1 mg This sequence belongs to salusin-a. Salusins are two newly discovered TOR-related peptides consisting of 28 and 20 amino acids and designated salusin-alpha and salusin-beta; respectively. Salusins are bioactive peptides with hemodynamic and mitogenic activities. Salusins improve calcium uptake and protein synthesis in neonatal rat cardiomyocytes; suggesting that salusins may be regulatory factors for myocardial growth and hypertrophy. Scientific data indicates the presence of salusin-alpha in human serum and urine SGALPPAPAAPRPALRAQRAGPAGPGAK-NH2 Ser-Gly-Ala-Leu-Pro-Pro-Ala-Pro-Ala-Ala-Pro-Arg-Pro-Ala-Leu-Arg-Ala-Gln-Arg-Ala-Gly-Pro-Ala-Gly-Pro-Gly-Ala-Lys-NH2
PGC-1? (205-216); Proliferator-activated Receptor Coactivator-1 ? (205-216) - Cat# 61293, 1 mg This is an acitylated and amidated form of the proliferator-activated receptor coactivator-1 ? (PGC-1 ?). It is reported to be not only an efficient coactivator of estrogen-related receptor (ERR); but also the inductor of it's expression. In the absence of PGC-1 ERR is a very weak activator of transcription. Coexpression of PGC-1 enables potent transcriptional activation by ERR. The LLXYL motif is very important site of interaction between ERR ? and PGC-1 ?. Ac-RPCSELLKYLTT-NH2 Ac-Arg-Pro-Cys-Ser-Glu-Leu-Leu-Lys-Tyr-Leu-Thr-Thr-NH2
JAG-1 (188-204); Jagged-1 (188-204); Notch Ligand - Cat# 61298, 1 mg This peptide is a fragment of the JAG-1 protein. JAG-1 is Notch ligand; a peptide that is the most conspicuously expressed ligand in skin. JAG-1 induces epidermal maturation. Exposing submerged keratinocytes monolayers to JAG-1 with elevated calcium concentration produces stratification with loricrin expression and NF-?B activation. CDDYYYGFGCNKFCRPR H-Cys-Asp-Asp-Tyr-Tyr-Tyr-Gly-Phe-Gly-Cys-Asn-Lys-Phe-Cys-Arg-Pro-Arg-OH
R-JAG (188-206) R-Jagged-1(188-206); Notch Ligand - Cat# 61299, 1 mg This peptide is derived from 188 to 204 amino acid regions of Jagged-1; but with specific amino acid changes. It triggers the kinase activety of kappaB kinase-alpha (IKKa); and has prominent expression in-vivo and enhancement during cell differentiation. CDDYYYGFGCNKFGRPRDD H-Cys-Asp-Asp-Tyr-Tyr-Tyr-Gly-Phe-Gly-Cys-Asn-Lys-Phe-Gly-Arg-Pro-Arg-Asp-Asp-OH
SRC-1 (682-697) - Cat# 61294, 1 mg This sequence is a steroid receptor coactivator-1 (SRC-1) amino acids 682 to 697. The SRC-1-derived peptide binds to the ERR ? LBD (estrogen-related receptor ? ligand binding domain). The ERR? LBD also exhibits an agonist conformation in presence of a coactivator derived from SRC-1. It was shown that the SRC-1 potentiates the transcriptional activity of ERR ?. SLTARHKILHRLLQEG H-Ser-Leu-Thr-Ala-Arg-His-Lys-Ile-Leu-His-Arg-Leu-Leu-Gln-Glu-Gly-OH
For more information visit http://www.anaspec.com/products/new.asp?l