Express Press Release Distribution

Accounting
Advertising
Aerospace
Agriculture
Apparel & Fashion
Automotive
Biotech
Chemicals
Computers
Construction
Consumer Services
Defense
Education
Electronics
Energy
Entertainment
Environment
Financial
Food & Beverage
Government
Healthcare
Human Resources
Industrial
International Trade
Internet & Online
Law
Management
Marketing
Media
Non Profit
Pharmaceuticals
Real Estate
Retail
Semiconductors
Small Business
Software
Sports
Telecommunications
Transportation / Logistics
Travel

EPR Archived News

Archived News 2012
~ April
~ March
~ February
~ January

Archived News 2011
~ December
~ November
~ October
~ September
~ August
~ July
~ June
~ May
~ April
~ March
~ February
~ January

Archived News 2010
Archived News 2009
Archived News 2008
Archived News 2007
Archived News 2006
Archived News 2005
Archived News 2004

 

AnaSpec Introduces Fifty New Catalog Peptides and 1 New Fluorescent Dye

Released on: April 24, 2008, 1:50 pm

Press Release Author: AnaSpec Inc.

Industry: Biotech

Press Release Summary: This week, AnaSpec introduced fifty (50) new catalog peptides
and one (1) new fluorescent dye.

Press Release Body: April 24, 2008 - San Jose, CA

This week AnaSpec, a world leader in integrated proteomics solutions, introduced
fifty (50) new catalog peptides and one (1) new fluorescent dye.

Hylambatin- Cat# 62792
Hylambatin belongs to the tachykinins. Hylambatin was isolated from Kassina maculata
(African rhacophorid frog; Hylambates maculatus) and is expressed in skin glands. It
is an amphibian defense peptide.
Sequence: DPPDPDRFYGMM-NH2

[Lys6]-Eledoisin (6-11)- Cat# 62627
This amino acids 6 to 11 fragment of eledoisin with Ala6 substituted by Lys6 is a
peptide of mollusk origin. It is a member of the tachykinin family of neuropeptides.
Eledoisin was first isolated from the posterior salivary glands of two mollusk
species Eledone muschata and E. aldovandi. All tachykinin peptides; including
eledoisin; share the same consensus C-terminal sequence Phe-Xxx-Gly-Leu-Met-NH2.
These peptides exhibit a wide and complex spectrum of pharmacological and
physiological activities such as powerful vasodilation; hypertensive action; and
stimulation of extravascular smooth muscle.
Sequence: KFIGLM-NH2

Ranatachykinin C- Cat# 62778
This ranatachykinin C peptide was isolated from the frog (Rana catesbeiana) brain
and intestine. It exhibits potent stimulant effect on smooth muscle preparation of
guinea pig ileum. This is one of four known ranatachykinin peptides. Ranatachykinins
A; B and C have the conserved C-terminal sequence; Phe- X- Gly- Leu- Met-NH2; a
sequence common to known members of the tachykinin family.
Sequence: HNPASFIGLM-NH2

Ranatachykinin B- Cat# 62777
This ranatachykinin B peptide was isolated from the frog (Rana catesbeiana) brain
and intestine. It exhibits potent stimulant effect on smooth muscle preparation of
guinea pig ileum. This is one of four ranatachykinin peptides. Ranatachykinins A; B
and C have the conserved C-terminal sequence; Phe- X- Gly- Leu- Met-NH2; a sequence
common to known members of the tachykinin family.
Sequence: YKSDSFYGLM-NH2

Histone H4 (1-7); N-Terminal- Cat# 62754
This is amino acids 1 to 7 fragment of the histone H3. Alterations in chromatin
structure; such as nucleosome sliding; removal of nucleosomes; and disruption of
DNA-histone or histone-histone contacts through post-translational modification of
the histones; have been linked to transcriptional regulation; DNA damage repair; and
replication; among other cellular processes. Modification of histones occurs
primarily in the N-terminal residues or tail region. These modifications include
phosphorylation; ubiquitinylation; methylation; sumolyation; and acetylation. Lys5
may serve as the acetylation site for this peptide.
Sequence: SGRGKGG

AMARA peptide- Cat# 62596
AMARA peptide is a minimal substrate for several members of the protein kinases
family. It contains the phosphorylation site for AMP-activated Protein Kinase
(AMPK). AMARA peptide may be employed in the applications to measure AMPK-related
kinase activity.
Sequence: AMARAASAAALARRR

Catestatin; human- Cat# 62513
Catestatin is amino acids 352 to 372 fragment of chromogranin A . Chromogranin A is
the endogenous compound that is able to inhibit catecholamine release elicited by
the activation of neuronal nicotinic acetylcholine receptors (nAChRs). nAChRs are
found in different animal species and catecholaminergic cell types.
Sequence: SSMKLSFRARAYGFRGPGPL

Valorphin- Cat# 62789
Valorphin is an opioid-like fragment of hemoglobin b-chain. Valorphin was isolated
from bovine hypothalamic tissue. It possesses some opiate activity.
Sequence: VVYPWTQ

LVV-Hemorphin-6; Leu-Valorphin-Arg- Cat# 62790
This peptide is amino acids 32 to 40 fragment of the beta-; delta-; gamma; and
sigma-chains of human hemoglobin. It possesses some opiate activity. This peptide
was isolated from the pituitary gland.
Sequence: LVVYPWTQR

MOG (101-120); human; mouse- Cat# 62370
This is amino acids 101 to 120 fragment of myelin oligodendrocyte glycoprotein
(MOG); one of the major MOG B-cell epitopes in transgenic mice. MOG is a potential
target antigen of the central nervous system known to induce autoreactive T cell
response and demyelinating anti-MOG antibodies in multiple sclerosis (MS) patients.
Studies demonstrated that a quantitatively minor myelin protein; MOG; is also
strongly encephalogenic in mice; rats; marmosets; and rhesus monkeys; which is
highly relevant to MS.
Sequence: RDHSYQEEAAMELKVEDPFY

Pevpyrokinin-2 (PPK-2; Pev-PK 2)- Cat# 62775
This pevpyrokinin-2 (PPK-2; Pev-PK 2) peptide belongs to the pyrokinin neuropeptides
and was isolated from white shrimp. Extract of 3500 central nervous systems of
female white shrimp Penaeus vannamei was screened for myotropic activity in order to
purify pyrokinin-like peptides that belong to the pyrokinin/PBAN neuropeptide
family. Members of this family regulate reproductive processes in insects; including
pheromone biosynthesis. The crustacean pyrokinins are the first to be found in a non
insect. PK peptides share the conserved C-terminal pentapeptide sequence FXPRLamide;
where X is a variable amino acid
Sequence: ADFAFSPRL-NH2

Pevpyrokinin-1 (PPK-1; Pev-PK 1)- Cat# 62774
This pevpyrokinin-1 peptide was isolated from the central nervous systems of female
white shrimp; Penaeus vannamei. Pev-PK 1 contains the typical FXPRL-NH2 (X = G; S; T
or V) C-terminal sequence that characterizes members of the versatile pyrokinin/PBAN
family These crustacean pyrokinins are the first to be found in a noninsect. Pev-PK
1 and Pev-PK 2 synthetic peptides display myotropic activity on the Leucophaea
maderae as well as on the Astacus leptodactylus hindgut.
Sequence: DFAFSPRL-NH2

Myomodulin- Cat# 62796
Myomodulin is a bioactive neuropeptide found in Aplysia neurons. It produces a
hyperpolarization in several Achatina neuron types.
Sequence: PMSMLRL-NH2

Leucokinin 3- Cat# 62799
Leucokinin-3 is an insect neuropeptide derived from Leucophaea maderae. This peptide
stimulates contractile activity of cockroach protodeum (hindgut).
Sequence: DQGFNSWG-NH2

Secretogranin I Precursor (585-594)- Cat# 62662
This peptide is amino acids 585 to 594 fragment of the secretogranin I precursor.
The same sequence belongs to the mature peptide; chromogranin B; parathyroid
secretory protein in rat.
Sequence: SFAKAPHLDL

Pituitary Adenylate Cyclase-Activating Polypeptide Precursor (111-128)- Cat# 62675
This is amino acids 111 to 128 fragment of the pituitary adenylate
cyclase-activating polypeptide precursor; also known as PACA_RAT 111.
Sequence: GMGENLAAAAVDDRAPLT

Gonadoliberin I (24-33)- Cat# 62671
This is amino acids 24 to 33 fragment of gonadoliberin 1; or gonadotropin-releasing
hormone I (GnRH I). It is identical in mouse; rat; human; sheep; cow; pig; etc. The
hypothalamic-pituitary GnRH system is composed of GnRH-I decapeptide hormone; and
type I GnRH receptors which are involved in the regulation of gonadotrophin
secretion from the anterior pituitary gland.
Sequence: QHWSYGLRPG

Delta-Sleep-Inducing Peptide (DSIP)- Cat# 62787
This delta-sleep-inducing peptide (DSIP) was isolated from rabbits. It induces
slow-wave (delta) and spindles electroencephalogram enhancement after
intraventricular (brain) infusion.
Sequence: WAGGDASGE

CART Protein Precursor (82-86)- Cat# 62707
This is amino acids 82 to 86 fragment of the cocaine- and amphetamine-regulated
transcript (CART) Protein Precursor; or amino acids 55 to 59 fragment of CART. This
is a section of the rat long form (rl) CART 55-102 bioactive peptide that opposes
the actions of cocaine.
Sequence: IPIYE

alpha-Neo-Endorphin- Cat# 62678
Alpha-Neo-Endorphin(alpha-NE) is a cleavage product of the prodynorphin. Alpha-NE
has been isolated from all vertebrates phyla; and from different tetrapods where it
shows similar biochemical properties; reflecting the great conservation of this
peptide in tetrapods.
Sequence: YGGFLRKYPK

Ecdysis-Triggering Hormone 1 (ETH1); Drosophila- Cat# 62801
This peptide is an insect ecdysis-triggering hormone (ETH). Inka cells from the
epitracheal glands produce hormones that are involved in regulation of insect
ecdysis. Injection of ETH is sufficient to elicit the entire ecdysis behavior.
Sequence: DDSSPGFFLKITKNVPRL-NH2

Preptin; Human Pro-Insulin Growth Factor II (69-80); mouse- Cat# 62431
This peptide belongs to the mouse preptin. Preptin is a recently isolated 34-amino
acid peptide hormone that is co-secreted with insulin and amylin from the pancreatic
beta-cells. Preptin corresponds to Asp69-Leu102 of pro-insulin growth factor II
(pro-IGF-II). Increased circulating levels of a pro-IGF-II peptide complexed with
IGF-binding protein-2 have been implicated in the high bone mass phenotype observed
in patients with chronic hepatitis C infection.
Sequence: DVSTSQAVLPDDFPRYPVGKFFQYDTWRQSAGRL

MOG (92-106)- Cat# 62732
This is amino acids 92 to 106 fragment of the myelin oligodendrocyte glycoprotein
(MOG). Mice with MOG (92-106)-induced experimental autoimmune encephalomyelitis
develop extensive B cell reactivity against secondary myelin antigens. Despite the
fact that this MOG peptide induces only weak T cell responses; MOG-induced
autoimmunity is very severe. This peptide is encephalitogenic in SJL mice; DA rats;
and rhesus monkeys.
Sequence: DEGGYTCFFRDHSYQ

P2 p57-81; Peripheral Myelin P2 Protein p57-81- Cat# 62083
This peptide was used to study the experimental autoimmune encephalomyelitis (EAE)
and induction of transferred EAE in mice. It is a neurotogenic peptide of P2
peripheral myelin.
Sequence: FKNTEISKLGQEFEETTADNRKTK

MBP (79-87)- Cat# 62733
This is an amino acids 79 to 87 fragment of the myelin basic protein (MBP).
Injection of this peptide induces a high avidity T cell repertoire in shiverer mice
that primarily consisted of clones capable of recognizing the native MBP protein; in
addition to the peptide itself. Endogenous MBP is not required for the positive
selection of an MBP-specific T cell repertoire. C3H mice; in contrast; are
selectively unresponsive to the MBP protein and injection of this MBP peptide
induces a low avidity repertoire that could be stimulated only by the peptide; not
by the protein.
Sequence: DENPVVHFF

NY-ESO-1 (87-111)- Cat# 62655
This is amino acids 81 to 111 fragment of the NY-ESO-1. The NY-ESO-1 antigen is
expressed by many tumors of different histological types (including breast;
prostate; lung; and melanoma) and by male germline cells; but not by other normal
tissues. NY-ESO-1 encodes MHC class I- and class II-restricted peptides expressed by
a diverse range of cancers and recognized by T cells. This peptide is pan-MHC class
II-restricted sequence that is capable of binding to multiple HLA-DR and HLA-DP4
molecules; including HLA-DRB1*0101; 0401; 0701; and 1101 and HLA-DPB1*0401 and 0402
molecules.
Sequence: LLEFYLAMPFATPMEAELARRSLAQ

BDC2.5 mimotope 1040-51- Cat# 62755
This is a strongly agonistic peptide (mimotope) for diabetogenic T cell clone
BDC2.5. from non-obese diabetic (NOD) mice. T cells from prediabetic and diabetic
NODs respond to BDC2.5 mimotope peptides. This peptide is important in autoimmune
diabetes research.
Sequence: RVLPLWVRME

BDC2.5 mimotope 1040-31- Cat# 62756
This is a strongly agonistic peptide (mimotope) for diabetogenic T cell clone
BDC2.5. It can stimulate BDC2.5 cells with cells showing good response to this
mimotope. 1040-31 peptide is specific for BDC2.5 TCR Tg+ (transgenic) T cells. This
peptide is also known as p31.
Sequence: YVRPLWVRME

MMK-1; amide- Cat# 62520
This is a formyl peptide receptor like 1 (FPRL1 ) antagonist peptide. MMK-1 was
reported to mobilize Ca2+ via lipoxin A4 receptors (ALXRs); and to stimulate human
polymorphonuclear leukocyte chemotaxis.
Sequence: LESIFRSLLFRVM-NH2

Dyrktide; TAMRA labeled- Cat# 62715
Dyrktide is designed as the optimal substrate sequence that is efficiently
phosphorylated by DYRK1A. DYRK1A is a dual-specificity protein kinase that is
thought to be involved in brain development. This peptide is labeled with TAMRA at
the N-terminus; Abs/Em = 544 nm/ 572 nm..
Sequence: 5-TAMRA-RRRFRPASPLRGPPK

Autoimmune Lupus Erythematosus Epitope 1- Cat# 62726
This small nuclear ribonucleoprotein Sm autoantigen B/B\'-derived octapeptide is
recognized by lupus erythematosus auto-antibodies. Autoantibodies binding the Sm B
and Sm B/B? peptides are commonly associated with systemic lupus erythematosus in
man and in MRLlpr/lpr mice. This region of Sm B/B? is a major area of antigenicity
in human sera.
Sequence: PPPGIRGP

Heparin-Binding Peptide V; scrambled- Cat# 62705
This is a scrambled sequence of the heparin-binding peptide V which is derived from
the III14 repeat of heparin-binding fibronectin fragment (HBFN-f). HBFN-f stimulates
NO production in a dose-dependent manner. Peptide V with heparin-binding ability
significantly reduces NO levels elevated by HBFN-f.
Sequence: RPQIPWAR

Orphanin FQ2; (OFQ2; NOCII)- Cat# 62609
Orphanin FQ2 (OFQ2); or NOCII; is a heptadecapeptide generated from prepronociceptin
(PPNOC); the same precursor as for nociceptin/orphanin FQ and nocistatin. NOCII is a
potent analgesic when administered both supraspinally and spinally.
Intracerebroventricular administration of NOCII increases locomotion in mice. NOCII
is a peptide whose sequence lies immediately downstream of nociceptin; the natural
agonist of the ORL1 receptor. The sequence of NOCII is framed by putative convertase
excision sites; and is totally conserved across murine and human species.
Sequence: FSEFMRQYLVLSMQSSQ

BQ123; Cyclo(-wdPvL-); Endothelin Antagonist- Cat# 62357
This peptide is a selective endothelin antagonist; a part of the Ca2+ metabolism.
BQ-123 is a non-competitive antagonist of the actions of endothelin-1 in SK-N-MC
human neuroblastoma cells.
Sequence: Cyclo(-wdPvL-)

Deltorphin B- Cat# 62683
Deltorphin B (or Deltorphin II) was first isolated from the skin of Phyllomedusa
bicolor.
Sequence: YaFEVVG-NH2

Deltorphin C- Cat# 62681
Deltorphin C; also known as deltorphin 1 is delta-opioid receptor agonist.
Sequence: YaFDVVG-NH2

Dynorphin B (1-9)- Cat# 62687
This is amino acids 1 to 9 fragment of the dynorphin B.
Sequence: YGGFLRRQF

Dynorphin B (1-13)- Cat# 62686
This is amino acids 1 to 13 fragment of the dynorphin B; also known as Rimorphin
Rimorphin is generated from dynorphin B-29 (leumorphin) by the cleavage at a single
Arg residue. Rimorphin has been purified from extracts of bovine posterior pituitary
glands. This unique peptide is a major [Leu]-enkephalin-containing peptide in all
tissues examined that contain dynorphin and alpha-neo-endorphin. A rat brain
membrane extract was also shown to convert synthetic dynorphin B-29 to rimorphin.
Sequence: YGGFLRRQFKVVT

Dermorphin- Cat# 62684
This peptide is ?-opioid receptor agonist
Sequence: YaFGYPS

Lipid Membrane Translocating Peptide; D-isomer- Cat# 62398
This is an all d-amino acids sequence of the lipid membrane translocating peptide.
It is a drug delivery peptide that is able to penetrate the lipid membranes.
Sequence: kkaaavllpvllaap

Survivin 2B (80-88)- Cat# 62693
This peptide is amino acids 80 to 88 fragment of survivin-2B. It is capable of
binding to HLA-A24. This peptide is a potent T-cell epitope eliciting CTL response
against a splicing variant survivin-2B; which is specifically expressed in many
kinds of cancer cells.
Sequence: AYACNTSTL

Tyrosinase (240-251)- Cat# 62711
This is amino acids 240 to 251 fragment of tyrosinase; the HLA-A1-restricted
epitope. This peptide is a incredibly immunogenic epitope used in melanoma vaccines
studies.
Sequence: DAEKSDICTDEY

MAGE-A 1(96-104)- Cat# 62709
This is amino acids 96 to 191 fragment of the MAGE-A1. This peptide is immunogenic
when administered to patients with stage IIB; III; or IV melanoma. It is considered
for inclusion in vaccines against cancers of many histologic types; in addition to
melanoma.
Sequence: SLFRAVITK

Metalnikowin IIA- Cat# 62602
Metalnikowin IIA is an antibacterial peptide active against Gram-negative bacteria.
Sequence: VDKPDYRPRPWPRPN

Drosocin- Cat# 62600
Drosocin is a 19-mer cationic antimicrobial peptide from Drosophila melanogaster. In
Drosophila native drosocin carries a disaccharide moiety attached to a threonine
residue in mid-chain position. This synthetic drosocin peptide of identical amino
acid sequence without the disaccharide has an activity several times lower than the
native compound.
Sequence: GKPRPYSPRPTSHPRPIRV

HspB8 (184-196); human- Cat# 62592
This is amino acids 184 to 196 fragment of the heat shock protein HspB8. The
C-terminal domain of HspB8 is necessary for chaperone activity. HspB8 is highly
expressed in the neuronal tissue; heart; brain. It was shown to affect on
beta-amyloid-mediated cytotoxicity; beta-amyloid aggregation and development of
senile plaques in Alzheimer\'s and other neurodegenerative diseases.
Sequence: NELPQDSQEVTCT

[Pro31]-Beta-Amyloid (1-42)- Cat# 62443
This beta-amyloid peptide (1-42) has Ile31 substituted with Pro31. Substitution of
Ile31 by the helix-breaking amino acid; proline; completely abrogates the oxidative
stress and neurotoxic properties of beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAPIGLMVGGVVIA

[Val33]-Beta-Amyloid (1-42)- Cat# 62442
This modified amino acids 1 to 42 fragment of the beta amyloid peptide has
substitution of Gly33 to Val33. This peptide shows almost no neuronal toxicity
compared to the native beta amyloid (1-42); as well as having significantly lowered
levels of oxidized proteins. It does not form fibrils nearly as well as beta amyloid
(1- 42); suggesting that Gly33 may be a possible site of free radical propagation
processes and contributes to the peptide's toxicity in Alzheimer's disease brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIVLMVGGVVIA

[Asn 6;13;14] -Beta-Amyloid (1-42)- Cat# 61958-01
This is a modified beta-amyloid (1-42) peptide; with histidines at positions 6; 13
and 14 replaced by asparagines.
Sequence: DAEFRNDSGYEVNNQKLVFFAEDVGSNKGAIIGLMVGGVVIA

gp100 (25-33); human- Cat# 62589
This is amino acids 25 to 33 fragment of human melanoma antigen gp100. This H-2Db
restricted epitope is recognized by T cells. The gp100-specific; H-2Db-restricted;
CD8+ T cells are capable of recognizing B16 melanoma but not normal melanocytes.
This peptide was used as an immunogen in multiple cancer immunotherapy studies.
Sequence: KVPRNQDWL

Acrylodan- Cat# 83305

Company Info
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to
pharmaceutical, biotech, and academic research institutions throughout the world.
With a vision for innovation through synergy, AnaSpec focuses on three core
technologies: peptides, detection reagents, and combinatorial chemistry.
Established in 1993, AnaSpec\'s headquarters and manufacturing facilities are located
in San Jose, CA.

For more information visit www.anaspec.com


Web Site: http://www.anaspec.com

Contact Details: AnaSpec Inc.
2149 O\'Toole Ave.
San Jose, CA 95131
1-408-452-5055 (Tel)
1-408-452-5059 (Fax)
1-800-452-5530
ping@anaspec.com
www.anaspec.com

  • Printer Friendly Format
  • Back to previous page...
  • Back to home page...
  • Submit your press releases...
  •